Tesamorelin 5mg
$45.49
Product Description
Tesamorelin is a growth hormone-releasing hormone (GHRH) analog that has been shown to increase growth hormone and IGF-1 levels.
Potential benefits of Tesamorelin:
- May support a sense of well-being.
- May improve energy levels.
- May support overall health.
- May support lean muscle.
- May support weight management.
- May support your body’s natural strength.
- May support muscle endurance and energy.
- May improve skin quality.
- May improve sleep quality.
Purity, Formulation & Physical Appearance
CellSpike Tesamorelin has a peptide purity level that exceeds 99.0% as determined by HPLC. This peptide was synthesized with no additives and is supplied as a white lyophilized (freeze-dried) powder.
Solubility & Storage
It is recommended to reconstitute the lyophilized Tesamorelin in bacteriostatic water, which can then be further diluted in other aqueous solutions. Lyophilized Tesamorelin although stable at room temperature for 90 days, should be stored between 2-8°C. Upon reconstitution, Tesamorelin should be stored between 2-8°C out of direct light for up to 14 days. For future use store below -18°C. Prevent repeated freeze-thaw cycles.
Product Usage
THIS PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. This product is not a drug and has not been approved by the FDA to prevent or cure any medical condition or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals.
Structure
Source: PubChem
Peptide Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Molecular Formula: C221H366N72O67S
Molecular Weight: 5136 g/mol
PubChem CID: 16137828
CAS Number: 804475-66-9
Additional information
Weight | 3 oz |
---|---|
Title | Default Title |