IGF-1 DES 1mg
$62.99
Product Description
IGF-1 DES inhibits the movement of glucose into the body cells which facilitates fat burning and the use of fat in the body for the production of energy.
Potential benefits of IGF-1 DES:
- May improve energy levels.
- May support overall health.
- May support lean muscle.
- May support your body’s natural strength.
- May support muscle endurance and energy.
- May help bones, ligaments, and tendons health.
Purity, Formulation & Physical Appearance
CellSpike IGF-1 DES has a peptide purity level that exceeds 99.0% as determined by HPLC. This peptide was synthesized with no additives and is supplied as a white lyophilized (freeze-dried) powder.
Solubility & Storage
It is recommended to reconstitute the lyophilized DES in bacteriostatic water, which can then be further diluted in other aqueous solutions. Lyophilized IGF-1 DES although stable at room temperature for 90 days, should be stored between 2-8°C. Upon reconstitution, IGF-1 LR3 should be stored between 2-8°C out of direct light for up to 14 days. For future use store below -18°C. Prevent repeated freeze-thaw cycles.
Product Usage
THIS PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. This product is not a drug and has not been approved by the FDA to prevent or cure any medical condition or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals.
Structure

Peptide Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKSA
Molecular Formula: C319H495N91O96S7
Molecular Weight: 7365.4225 g/mol
PubChem CID: 135331146
CAS Number: 112603-35-7
Additional information
Weight | 3 oz |
---|---|
Title | Default Title |